Anti-CEP350

Catalog Number: ATA-HPA028355
Article Name: Anti-CEP350
Biozol Catalog Number: ATA-HPA028355
Supplier Catalog Number: HPA028355
Alternative Catalog Number: ATA-HPA028355-100,ATA-HPA028355-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAP350, KIAA0480
centrosomal protein 350kDa
Anti-CEP350
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 9857
UniProt: Q5VT06
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ESEAKKLAGASINYGSAWNTEYDVQQAPQEDGPWTKAVTPPVKDDNEDVFSARIQKMLGSCVSHATFDDDLPGVGNLSEFKKLPEMIRPQSAISSFRVRSPGPK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CEP350
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-CEP350 antibody HPA028355 (A) shows similar protein distribution across tissues to independent antibody HPA028357 (B).
Immunohistochemical staining of human cerebral cortex using Anti-CEP350 antibody HPA028355.
Immunohistochemical staining of human kidney using Anti-CEP350 antibody HPA028355.
Immunohistochemical staining of human testis using Anti-CEP350 antibody HPA028355.
Immunohistochemical staining of human colon using Anti-CEP350 antibody HPA028355.
HPA028355-100ul
HPA028355-100ul
HPA028355-100ul