Anti-DNAJB4
Catalog Number:
ATA-HPA028385
- Images (4)
| Article Name: | Anti-DNAJB4 |
| Biozol Catalog Number: | ATA-HPA028385 |
| Supplier Catalog Number: | HPA028385 |
| Alternative Catalog Number: | ATA-HPA028385-100,ATA-HPA028385-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HLJ1 |
| DnaJ (Hsp40) homolog, subfamily B, member 4 |
| Anti-DNAJB4 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 11080 |
| UniProt: | Q9UDY4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAJB4 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells. |
|
|
HPA028385-100ul |
|
|
HPA028385-100ul |
Product Guarantee and Expert Support
