Anti-PRUNE1

Catalog Number: ATA-HPA028411
Article Name: Anti-PRUNE1
Biozol Catalog Number: ATA-HPA028411
Supplier Catalog Number: HPA028411
Alternative Catalog Number: ATA-HPA028411-100,ATA-HPA028411-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DRES-17, H-PRUNE, HTCD37, PRUNE
prune exopolyphosphatase
Anti-PRUNE1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 58497
UniProt: Q86TP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PRUNE1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA028411-100ul
HPA028411-100ul
HPA028411-100ul