Anti-CSK
Catalog Number:
ATA-HPA028425
- Images (9)
| Article Name: | Anti-CSK |
| Biozol Catalog Number: | ATA-HPA028425 |
| Supplier Catalog Number: | HPA028425 |
| Alternative Catalog Number: | ATA-HPA028425-100,ATA-HPA028425-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CSK |
| c-src tyrosine kinase |
| Anti-CSK |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 1445 |
| UniProt: | P41240 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CSK |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles. |
|
|
Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells. |
|
|
Western blot analysis in human cell line RT-4 and human cell line HeLa. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA028425-100ul |
|
|
|
|
|
|
|
|
HPA028425-100ul |
|
|
HPA028425-100ul |
Product Guarantee and Expert Support
