Anti-TPD52
Catalog Number:
ATA-HPA028427
- Images (9)
| Article Name: | Anti-TPD52 |
| Biozol Catalog Number: | ATA-HPA028427 |
| Supplier Catalog Number: | HPA028427 |
| Alternative Catalog Number: | ATA-HPA028427-100,ATA-HPA028427-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | D52, hD52, N8L |
| tumor protein D52 |
| Anti-TPD52 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 7163 |
| UniProt: | P55327 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | TPD52 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human prostate and skeletal muscle tissues using Anti-TPD52 antibody. Corresponding TPD52 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, kidney, prostate and skeletal muscle using Anti-TPD52 antibody HPA028427 (A) shows similar protein distribution across tissues to independent antibody HPA062167 (B). |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human kidney using Anti-TPD52 antibody HPA028427. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TPD52 antibody HPA028427. |
|
|
HPA028427-100ul |
|
|
HPA028427-100ul |
|
|
HPA028427-100ul |
Product Guarantee and Expert Support
