Anti-HENMT1
Catalog Number:
ATA-HPA028464
- Images (9)
| Article Name: | Anti-HENMT1 |
| Biozol Catalog Number: | ATA-HPA028464 |
| Supplier Catalog Number: | HPA028464 |
| Alternative Catalog Number: | ATA-HPA028464-100,ATA-HPA028464-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C1orf59, FLJ30525, HEN1 |
| HEN1 methyltransferase homolog 1 (Arabidopsis) |
| Anti-HENMT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 113802 |
| UniProt: | Q5T8I9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MEENNLQCSSVVDGNFEEVPRETAIQFKPPLYRQRYQFVKNLVDQHEPKKVADLGCGDTSLLRLLKVNPCIELLVGV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HENMT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate to strong nuclear and cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine and endocrine glandular cells. |
|
|
Immunohistochemical staining of human lymph node shows strong nuclear positivity in germinal center cells. |
|
|
Immunohistochemical staining of colon shows moderate positivity in glandular cells. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and HENMT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408292). |
|
|
HPA028464-100ul |
|
|
|
|
|
HPA028464-100ul |
|
|
HPA028464-100ul |
Product Guarantee and Expert Support
