Anti-EXOSC10
Catalog Number:
ATA-HPA028470
- Images (7)
| Article Name: | Anti-EXOSC10 |
| Biozol Catalog Number: | ATA-HPA028470 |
| Supplier Catalog Number: | HPA028470 |
| Alternative Catalog Number: | ATA-HPA028470-100,ATA-HPA028470-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | p2, p3, p4, PM-Scl, PM/Scl-100, PMSCL2, RRP6, Rrp6p |
| exosome component 10 |
| Anti-EXOSC10 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5394 |
| UniProt: | Q01780 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | EXOSC10 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human esophagus shows strong nucleolar positivity in superficial squamous epithelial cells. |
|
|
Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EXOSC10 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and EXOSC10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424312). |
|
|
HPA028470-100ul |
|
|
|
|
|
HPA028470-100ul |
|
|
HPA028470-100ul |
Product Guarantee and Expert Support
