Anti-AUNIP
Catalog Number:
ATA-HPA028730
- Images (8)
| Article Name: | Anti-AUNIP |
| Biozol Catalog Number: | ATA-HPA028730 |
| Supplier Catalog Number: | HPA028730 |
| Alternative Catalog Number: | ATA-HPA028730-100,ATA-HPA028730-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AIBp, C1orf135, MGC2603 |
| aurora kinase A and ninein interacting protein |
| Anti-AUNIP |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79000 |
| UniProt: | Q9H7T9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | CGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFTLQPGKTNGSDQTSVSSHTESQIN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | AUNIP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome. |
|
|
Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and AUNIP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411413). |
|
|
HPA028730-100ul |
|
|
|
|
|
|
|
|
HPA028730-100ul |
|
|
HPA028730-100ul |
Product Guarantee and Expert Support
