Anti-CDCA8
Catalog Number:
ATA-HPA028783
- Images (9)
| Article Name: | Anti-CDCA8 |
| Biozol Catalog Number: | ATA-HPA028783 |
| Supplier Catalog Number: | HPA028783 |
| Alternative Catalog Number: | ATA-HPA028783-100,ATA-HPA028783-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BOR, DasraB, FLJ12042, MESRGP |
| cell division cycle associated 8 |
| Anti-CDCA8 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 55143 |
| UniProt: | Q53HL2 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CDCA8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and kidney tissues using Anti-CDCA8 antibody. Corresponding CDCA8 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line U-251 MG |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and CDCA8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402655). |
|
|
HPA028783-100ul |
|
|
|
|
|
HPA028783-100ul |
|
|
HPA028783-100ul |
Product Guarantee and Expert Support
