Anti-PRSS27

Catalog Number: ATA-HPA028848
Article Name: Anti-PRSS27
Biozol Catalog Number: ATA-HPA028848
Supplier Catalog Number: HPA028848
Alternative Catalog Number: ATA-HPA028848-100,ATA-HPA028848-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAPH2, MPN
Clonality: Polyclonal
Isotype: IgG
NCBI: 83886
UniProt: Q9BQR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNC
Target: PRSS27
Antibody Type: Monoclonal Antibody
HPA028848-100ul