Anti-PACSIN1

Catalog Number: ATA-HPA028852
Article Name: Anti-PACSIN1
Biozol Catalog Number: ATA-HPA028852
Supplier Catalog Number: HPA028852
Alternative Catalog Number: ATA-HPA028852-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SDPI
protein kinase C and casein kinase substrate in neurons 1
Anti-PACSIN1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 29993
UniProt: Q9BY11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNW
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PACSIN1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using Anti-PACSIN1 antibody. Corresponding PACSIN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA028852-100ul
HPA028852-100ul
HPA028852-100ul