Anti-APLP1

Catalog Number: ATA-HPA028971
Article Name: Anti-APLP1
Biozol Catalog Number: ATA-HPA028971
Supplier Catalog Number: HPA028971
Alternative Catalog Number: ATA-HPA028971-100,ATA-HPA028971-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: APLP
amyloid beta (A4) precursor-like protein 1
Anti-APLP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 333
UniProt: P51693
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAVVGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: APLP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-APLP1 antibody. Corresponding APLP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and APLP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401581).
HPA028971-100ul
HPA028971-100ul
HPA028971-100ul