Anti-HOXA3, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-HOXA3, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA029157
• Supplier Catalog Number: HPA029157
• Alternative Catalog Number: ATA-HPA029157-100,ATA-HPA029157-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: HOX1, HOX1E

Product Description

homeobox A3

Additional Information

Anti-HOXA3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 3200
• UniProt: O43365
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: KATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSAPPSQP
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemical staining of human tonsil shows moderate nuclear positivity in germinal center cells.