Anti-SERPINH1

Catalog Number: ATA-HPA029198
Article Name: Anti-SERPINH1
Biozol Catalog Number: ATA-HPA029198
Supplier Catalog Number: HPA029198
Alternative Catalog Number: ATA-HPA029198-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CBP1, CBP2, colligen, HSP47, SERPINH2
serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Anti-SERPINH1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 871
UniProt: P50454
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSAFCLLEAALAAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSNSTARNVTWKL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SERPINH1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
Immunohistochemical staining of human vulva/anal skin shows moderate cytoplasmic positivity in epidermal cells.
Western blot analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-SERPINH1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA029198-100ul
HPA029198-100ul
HPA029198-100ul