Anti-DNPH1
Catalog Number:
ATA-HPA029675
- Images (8)
| Article Name: | Anti-DNPH1 |
| Biozol Catalog Number: | ATA-HPA029675 |
| Supplier Catalog Number: | HPA029675 |
| Alternative Catalog Number: | ATA-HPA029675-100,ATA-HPA029675-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C6orf108, dJ330M21.3, rcl |
| 2-deoxynucleoside 5-phosphate N-hydrolase 1 |
| Anti-DNPH1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 10591 |
| UniProt: | O43598 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNPH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human duodenum and testis tissues using Anti-DNPH1 antibody. Corresponding DNPH1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows high expression. |
|
|
Immunohistochemical staining of human testis shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA029675-100ul |
|
|
|
|
|
HPA029675-100ul |
|
|
HPA029675-100ul |
Product Guarantee and Expert Support
