Anti-NRIP1

Catalog Number: ATA-HPA029785
Article Name: Anti-NRIP1
Biozol Catalog Number: ATA-HPA029785
Supplier Catalog Number: HPA029785
Alternative Catalog Number: ATA-HPA029785-100,ATA-HPA029785-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RIP140
Clonality: Polyclonal
Isotype: IgG
NCBI: 8204
UniProt: P48552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ
Target: NRIP1
Antibody Type: Monoclonal Antibody
HPA029785-100ul