Anti-GADD45B
Catalog Number:
ATA-HPA029816
- Images (9)
| Article Name: | Anti-GADD45B |
| Biozol Catalog Number: | ATA-HPA029816 |
| Supplier Catalog Number: | HPA029816 |
| Alternative Catalog Number: | ATA-HPA029816-100,ATA-HPA029816-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DKFZP566B133, GADD45BETA, MYD118 |
| growth arrest and DNA-damage-inducible, beta |
| Anti-GADD45B |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 4616 |
| UniProt: | O75293 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GADD45B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows weak positivity in a subset of myocytes. |
|
|
HPA029816-100ul |
|
|
|
|
|
HPA029816-100ul |
|
|
HPA029816-100ul |
Product Guarantee and Expert Support
