Anti-PNRC1
Catalog Number:
ATA-HPA029839
- Images (9)
| Article Name: | Anti-PNRC1 |
| Biozol Catalog Number: | ATA-HPA029839 |
| Supplier Catalog Number: | HPA029839 |
| Alternative Catalog Number: | ATA-HPA029839-100,ATA-HPA029839-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | B4-2, PROL2, PRR2 |
| proline-rich nuclear receptor coactivator 1 |
| Anti-PNRC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 10957 |
| UniProt: | Q12796 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PNRC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human lung shows weak to moderate cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA029839-100ul |
|
|
|
|
|
HPA029839-100ul |
|
|
HPA029839-100ul |
Product Guarantee and Expert Support
