Anti-CLDND1

Catalog Number: ATA-HPA029841
Article Name: Anti-CLDND1
Biozol Catalog Number: ATA-HPA029841
Supplier Catalog Number: HPA029841
Alternative Catalog Number: ATA-HPA029841-100,ATA-HPA029841-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C3orf4
claudin domain containing 1
Anti-CLDND1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 56650
UniProt: Q9NY35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CLDND1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemical staining of human testis shows strong nucleus and cytoplasmic positivity of cells in seminiferous ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and CLDND1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412679).
HPA029841-100ul
HPA029841-100ul
HPA029841-100ul