Anti-CAMP
Catalog Number:
ATA-HPA029874
- Images (9)
| Article Name: | Anti-CAMP |
| Biozol Catalog Number: | ATA-HPA029874 |
| Supplier Catalog Number: | HPA029874 |
| Alternative Catalog Number: | ATA-HPA029874-100,ATA-HPA029874-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAP18, FALL-39, FALL39, LL37 |
| cathelicidin antimicrobial peptide |
| Anti-CAMP |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 820 |
| UniProt: | None |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CAMP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA029874 antibody. Corresponding CAMP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human bone marrow shows moderate to strong granular cytoplasmic positivity in hematopoietic cells. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong granular cytoplasmic positivity in leukocytes. |
|
|
Immunohistochemical staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected. |
|
|
Western blot analysis in human plasma. |
|
|
HPA029874-100ul |
|
|
|
|
|
HPA029874-100ul |
|
|
HPA029874-100ul |
Product Guarantee and Expert Support
