Anti-NUFIP1
Catalog Number:
ATA-HPA029958
- Images (9)
| Article Name: | Anti-NUFIP1 |
| Biozol Catalog Number: | ATA-HPA029958 |
| Supplier Catalog Number: | HPA029958 |
| Alternative Catalog Number: | ATA-HPA029958-100,ATA-HPA029958-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | NUFIP |
| nuclear fragile X mental retardation protein interacting protein 1 |
| Anti-NUFIP1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 26747 |
| UniProt: | Q9UHK0 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUFIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human testis shows strong positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human cerebellum shows moderate positivity in nuclear speckles in Purkinje cells. |
|
|
HPA029958-100ul |
|
|
|
|
|
HPA029958-100ul |
|
|
HPA029958-100ul |
Product Guarantee and Expert Support
