Anti-NUDT17
Catalog Number:
ATA-HPA030145
- Images (8)
| Article Name: | Anti-NUDT17 |
| Biozol Catalog Number: | ATA-HPA030145 |
| Supplier Catalog Number: | HPA030145 |
| Alternative Catalog Number: | ATA-HPA030145-100,ATA-HPA030145-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ34433 |
| nudix (nucleoside diphosphate linked moiety X)-type motif 17 |
| Anti-NUDT17 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 200035 |
| UniProt: | P0C025 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLPPSV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NUDT17 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to centrosome. |
|
|
Immunohistochemistry analysis in human testis and liver tissues using Anti-NUDT17 antibody. Corresponding NUDT17 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
HPA030145 |
|
|
|
|
|
HPA030145 |
|
|
HPA030145 |
Product Guarantee and Expert Support
