Anti-LTV1

Catalog Number: ATA-HPA030160
Article Name: Anti-LTV1
Biozol Catalog Number: ATA-HPA030160
Supplier Catalog Number: HPA030160
Alternative Catalog Number: ATA-HPA030160-100,ATA-HPA030160-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf93, dJ468K18.4, FLJ14909
LTV1 ribosome biogenesis factor
Anti-LTV1
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 84946
UniProt: Q96GA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LEGSIQVDSNRLQEVLNDYYKEKAENCVKLNTLEPLEDQDLPMNELDESEEEEMITVVLEEAKEKWDCESICSTYSNLYNHPQLIKYQPKPKQ
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: LTV1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Western blot analysis in control (vector only transfected HEK293T lysate) and LTV1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409894).
HPA030160-100ul
HPA030160
HPA030160
HPA030160-100ul
HPA030160-100ul