Anti-CEP162
Catalog Number:
ATA-HPA030170
- Images (8)
| Article Name: | Anti-CEP162 |
| Biozol Catalog Number: | ATA-HPA030170 |
| Supplier Catalog Number: | HPA030170 |
| Alternative Catalog Number: | ATA-HPA030170-100,ATA-HPA030170-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | C6orf84, KIAA1009, QN1 |
| centrosomal protein 162kDa |
| Anti-CEP162 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 22832 |
| UniProt: | Q5TB80 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VLLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTGVSYGQSSSDVEALHQAYCHIAHSLGDEDKQKIESNTVEDIKSSVKGHPQEN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CEP162 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human placenta shows strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong positivity in cilia in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts, as well as nuclear positivity in a subset of cells. |
|
|
Immunohistochemical staining of human endometrium shows strong positivity in cilia in glandular cells, as well as modertae cytoplasmic and nuclear positivity in a subset of cells. |
|
|
HPA030170-100ul |
|
|
HPA030170-100ul |
|
|
HPA030170-100ul |
Product Guarantee and Expert Support
