Anti-UFD1

Catalog Number: ATA-HPA030286
Article Name: Anti-UFD1
Biozol Catalog Number: ATA-HPA030286
Supplier Catalog Number: HPA030286
Alternative Catalog Number: ATA-HPA030286-100,ATA-HPA030286-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: UFD1L
Clonality: Polyclonal
Isotype: IgG
NCBI: 7353
UniProt: Q92890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR
Target: UFD1
Antibody Type: Monoclonal Antibody
HPA030286-100ul