Anti-IMPG1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-IMPG1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA030332
• Supplier Catalog Number: HPA030332
• Alternative Catalog Number: ATA-HPA030332-100,ATA-HPA030332-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GP147, IPM150, SPACR

Product Description

interphotoreceptor matrix proteoglycan 1

Additional Information

Anti-IMPG1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 3617
• UniProt: Q17R60
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DSNKIESEEVYHGTMEEDKQPEIYLTATDLKRLISKALEEEQSLDVGTIQFTDEIAGSLPAFGPDTQSELPTSFAVITEDATLSPELPPVEPQLE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: IMPG1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemical staining of human cerebral cortex, colon, eye, retina and kidney using Anti-IMPG1 antibody HPA030332 (A) shows similar protein distribution across tissues to independent antibody HPA027142 (B).

Immunohistochemical staining of human colon using Anti-IMPG1 antibody HPA030332.

Immunohistochemical staining of human eye, retina using Anti-IMPG1 antibody HPA030332.

Immunohistochemical staining of human cerebral cortex using Anti-IMPG1 antibody HPA030332.

Immunohistochemical staining of human kidney using Anti-IMPG1 antibody HPA030332.

HPA030332

HPA030332

HPA030332