Anti-YY2 Antibody , Unconjugated, Rabbit, Polyclonal ChIP certified

Product Overview

• Article Name: Anti-YY2 Antibody , Unconjugated, Rabbit, Polyclonal ChIP certified
• Biozol Catalog Number: ATA-HPA030335
• Supplier Catalog Number: HPA030335
• Alternative Catalog Number: ATA-HPA030335-100,ATA-HPA030335-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ZNF631

Product Description

YY2 transcription factor

Additional Information

Anti-YY2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 404281
• UniProt: O15391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTL
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: YY2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500

Images

Immunofluorescent staining of human cell line HeLa shows localization to nuclear bodies.

Immunohistochemistry analysis in human testis and prostate tissues using Anti-YY2 antibody. Corresponding YY2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human testis shows high expression.

Immunohistochemical staining of human prostate shows low expression as expected.

HPA030335

HPA030335

HPA030335