Anti-ARHGAP28

Catalog Number: ATA-HPA030413
Article Name: Anti-ARHGAP28
Biozol Catalog Number: ATA-HPA030413
Supplier Catalog Number: HPA030413
Alternative Catalog Number: ATA-HPA030413-100,ATA-HPA030413-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10312, KIAA1314
Rho GTPase activating protein 28
Anti-ARHGAP28
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 79822
UniProt: Q9P2N2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGL
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ARHGAP28
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ARHGAP28 antibody. Corresponding ARHGAP28 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
HPA030413-100ul
HPA030413-100ul
HPA030413-100ul