Anti-XPNPEP1

Catalog Number: ATA-HPA030420
Article Name: Anti-XPNPEP1
Biozol Catalog Number: ATA-HPA030420
Supplier Catalog Number: HPA030420
Alternative Catalog Number: ATA-HPA030420-100,ATA-HPA030420-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: XPNPEP, XPNPEPL, XPNPEPL1
X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Anti-XPNPEP1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 7511
UniProt: Q9NQW7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: XPNPEP1
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
Western blot analysis using Anti-XPNPEP1 antibody HPA030420 (A) shows similar pattern to independent antibody HPA030419 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA030420-100ul
HPA030420-100ul
HPA030420-100ul