Anti-CHST7

Catalog Number: ATA-HPA030503
Article Name: Anti-CHST7
Biozol Catalog Number: ATA-HPA030503
Supplier Catalog Number: HPA030503
Alternative Catalog Number: ATA-HPA030503-100,ATA-HPA030503-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6ST-2, C6ST2
Clonality: Polyclonal
Isotype: IgG
NCBI: 56548
UniProt: Q9NS84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQL
Target: CHST7
Antibody Type: Monoclonal Antibody
HPA030503-100ul