Anti-ZGRF1

Catalog Number: ATA-HPA030705
Article Name: Anti-ZGRF1
Biozol Catalog Number: ATA-HPA030705
Supplier Catalog Number: HPA030705
Alternative Catalog Number: ATA-HPA030705-100,ATA-HPA030705-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C4orf21, FLJ11331
Clonality: Polyclonal
Concentration: 0,1
NCBI: 55345
UniProt: Q86YA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SAFFGPSSINEIEILPLKGYFPSNWPTNMVVHALLVCNASTELTTLKNIQDYFNPATLPLTQYLLTTSSPTIVSNKRVSKRKFIPPAFTNVSTK
Target: ZGRF1
HPA030705-100ul