Anti-FOSL1

Catalog Number: ATA-HPA030728
Article Name: Anti-FOSL1
Biozol Catalog Number: ATA-HPA030728
Supplier Catalog Number: HPA030728
Alternative Catalog Number: ATA-HPA030728-100,ATA-HPA030728-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: fra-1
Clonality: Polyclonal
Isotype: IgG
NCBI: 8061
UniProt: P15407
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPE
Target: FOSL1
Antibody Type: Monoclonal Antibody
HPA030728-100ul