Anti-ARHGEF40

Catalog Number: ATA-HPA030745
Article Name: Anti-ARHGEF40
Biozol Catalog Number: ATA-HPA030745
Supplier Catalog Number: HPA030745
Alternative Catalog Number: ATA-HPA030745-100,ATA-HPA030745-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ10357, solo
Clonality: Polyclonal
Isotype: IgG
NCBI: 55701
UniProt: Q8TER5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQWELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGS
Target: ARHGEF40
Antibody Type: Monoclonal Antibody
HPA030745-100ul