Anti-PAX6
Catalog Number:
ATA-HPA030775
- Images (9)
| Article Name: | Anti-PAX6 |
| Biozol Catalog Number: | ATA-HPA030775 |
| Supplier Catalog Number: | HPA030775 |
| Alternative Catalog Number: | ATA-HPA030775-100,ATA-HPA030775-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AN, AN2, D11S812E, WAGR |
| paired box 6 |
| Anti-PAX6 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 5080 |
| UniProt: | P26367 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PAX6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human cerebellum shows moderate to strong nuclear positivity in cells in granular layer. |
|
|
Immunohistochemical staining of human pancreas shows moderate to strong nuclear positivity in islets of Langerhans. |
|
|
Immunohistochemical staining of human endometrium shows no positivity as expected. |
|
|
Immunohistochemical staining of human stomach shows strong nuclear positivity in a subset glandular cells. |
|
|
HPA030775-100ul |
|
|
|
|
|
HPA030775-100ul |
|
|
HPA030775-100ul |
Product Guarantee and Expert Support
