Anti-ZNF354C Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA030904
- Images (8)
| Article Name: | Anti-ZNF354C Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA030904 |
| Supplier Catalog Number: | HPA030904 |
| Alternative Catalog Number: | ATA-HPA030904-100,ATA-HPA030904-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ChIP, ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KID3 |
| zinc finger protein 354C |
| Anti-ZNF354C |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 30832 |
| UniProt: | Q86Y25 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LVSLGIPFSMPKLIHQLQQGEDPCMVEREVPSDTRLGFKTWLETEALPHRQDIFIEETSQGMVKKESIKDGHWDINFEEAVEFE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZNF354C |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear membrane & cytosol. |
|
|
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA030904 |
|
|
|
|
|
|
|
|
HPA030904 |
|
|
HPA030904 |
Product Guarantee and Expert Support
