Anti-C2CD2

Catalog Number: ATA-HPA030922
Article Name: Anti-C2CD2
Biozol Catalog Number: ATA-HPA030922
Supplier Catalog Number: HPA030922
Alternative Catalog Number: ATA-HPA030922-100,ATA-HPA030922-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C21orf25, C21orf258, DKFZP586F0422, TMEM24L
C2 calcium-dependent domain containing 2
Anti-C2CD2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Isotype: IgG
NCBI: 25966
UniProt: Q9Y426
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPPEEAESAQASLAPKPQEDELDSWDLEKEP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: C2CD2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using Anti-C2CD2 antibody. Corresponding C2CD2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human adrenal gland shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA030922
HPA030922
HPA030922