Anti-TACC2

Catalog Number: ATA-HPA031021
Article Name: Anti-TACC2
Biozol Catalog Number: ATA-HPA031021
Supplier Catalog Number: HPA031021
Alternative Catalog Number: ATA-HPA031021-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AZU-1
transforming, acidic coiled-coil containing protein 2
Anti-TACC2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10579
UniProt: O95359
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ESPCPVGEPPLALENAASLKLFAGSLAPLLQPGAAGGEIPAVQASSGSPKARTTEGPVDSMPCLDRMPLLAKGKQATGEEKAATAPGA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TACC2
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skeletal muscle and lymph node tissues using Anti-TACC2 antibody. Corresponding TACC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human lymph node shows low expression as expected.
Western blot analysis in human cell line RT-4.
HPA031021-100ul
HPA031021-100ul
HPA031021-100ul