Anti-RPS6

Catalog Number: ATA-HPA031153
Article Name: Anti-RPS6
Biozol Catalog Number: ATA-HPA031153
Supplier Catalog Number: HPA031153
Alternative Catalog Number: ATA-HPA031153-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: S6
ribosomal protein S6
Anti-RPS6
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 6194
UniProt: P62753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSK
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RPS6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line MOLT-4
HPA031153-100ul
HPA031153-100ul
HPA031153-100ul