Anti-JUN

Catalog Number: ATA-HPA031174
Article Name: Anti-JUN
Biozol Catalog Number: ATA-HPA031174
Supplier Catalog Number: HPA031174
Alternative Catalog Number: ATA-HPA031174-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: AP-1, c-Jun
Clonality: Polyclonal
Isotype: IgG
NCBI: 3725
UniProt: P05412
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQE
Target: JUN
Antibody Type: Monoclonal Antibody
HPA031174-100ul