Anti-DNAJC6

Catalog Number: ATA-HPA031182
Article Name: Anti-DNAJC6
Biozol Catalog Number: ATA-HPA031182
Supplier Catalog Number: HPA031182
Alternative Catalog Number: ATA-HPA031182-100,ATA-HPA031182-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0473
DnaJ (Hsp40) homolog, subfamily C, member 6
Anti-DNAJC6
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 9829
UniProt: O75061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNAJC6
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-DNAJC6 antibody. Corresponding DNAJC6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA031182-100ul
HPA031182-100ul
HPA031182-100ul