Anti-RSPH4A

Catalog Number: ATA-HPA031198
Article Name: Anti-RSPH4A
Biozol Catalog Number: ATA-HPA031198
Supplier Catalog Number: HPA031198
Alternative Catalog Number: ATA-HPA031198-100,ATA-HPA031198-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
radial spoke head 4 homolog A (Chlamydomonas)
Anti-RSPH4A
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 345895
UniProt: Q5TD94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: RSPH4A
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-RSPH4A antibody. Corresponding RSPH4A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA031198-100ul
HPA031198-100ul
HPA031198-100ul