Anti-RSPH4A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RSPH4A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA031198
• Supplier Catalog Number: HPA031198
• Alternative Catalog Number: ATA-HPA031198-100,ATA-HPA031198-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B

Product Description

radial spoke head 4 homolog A (Chlamydomonas)

Additional Information

Anti-RSPH4A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 345895
• UniProt: Q5TD94
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: DVSYNNAKQKELRFDVFQEEDSNSDYDLQQPAPGGSEVAPSMLEITIQNAKAYLLKTSSNSGFNLYDHLSNMLTKI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RSPH4A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200

Images

Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-RSPH4A antibody. Corresponding RSPH4A RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human fallopian tube shows high expression.

Immunohistochemical staining of human liver shows low expression as expected.

HPA031198

HPA031198

HPA031198