Anti-UBL4B

Catalog Number: ATA-HPA031364
Article Name: Anti-UBL4B
Biozol Catalog Number: ATA-HPA031364
Supplier Catalog Number: HPA031364
Alternative Catalog Number: ATA-HPA031364-100,ATA-HPA031364-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ25690
ubiquitin-like 4B
Anti-UBL4B
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 164153
UniProt: Q8N7F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KVPEEQQHLLFRGQLLEDDKHLSDYCIGPNASINVIMQPLEKMALKEAHQPQTQPLWHQLGLVLAKHFEP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: UBL4B
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-UBL4B antibody. Corresponding UBL4B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows low expression as expected.
Immunohistochemical staining of human testis shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and UBL4B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404349).
HPA031364-100ul
HPA031364-100ul
HPA031364-100ul