Anti-DDX43

Catalog Number: ATA-HPA031381
Article Name: Anti-DDX43
Biozol Catalog Number: ATA-HPA031381
Supplier Catalog Number: HPA031381
Alternative Catalog Number: ATA-HPA031381-100,ATA-HPA031381-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT13, DKFZp434H2114, HAGE
DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Anti-DDX43
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55510
UniProt: Q9NXZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DDX43
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and endometrium tissues using Anti-DDX43 antibody. Corresponding DDX43 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human endometrium shows low expression as expected.
Western blot analysis in human cell line CAPAN-2.
HPA031381-100ul
HPA031381-100ul
HPA031381-100ul