Anti-EXOC4 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA031443
Article Name: Anti-EXOC4 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA031443
Supplier Catalog Number: HPA031443
Alternative Catalog Number: ATA-HPA031443-100,ATA-HPA031443-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1699, MGC27170, SEC8, SEC8L1, Sec8p
exocyst complex component 4
Anti-EXOC4
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 60412
UniProt: Q96A65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QHKFQYIFEGLGHLISCILINGAQYFRRISESGIKKMCRNIFVLQQNLTNITMSREADLDFARQYYEMLYNTADELLNLVVDQGVKYTELEYIHALTLLHRSQTGVGELTTQNTRLQRLKEIICEQAAIKQATKD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: EXOC4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA031443
HPA031443
HPA031443