Anti-GMDS

Catalog Number: ATA-HPA031528
Article Name: Anti-GMDS
Biozol Catalog Number: ATA-HPA031528
Supplier Catalog Number: HPA031528
Alternative Catalog Number: ATA-HPA031528-100
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GMD, SDR3E1
GDP-mannose 4,6-dehydratase
Anti-GMDS
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 2762
UniProt: O60547
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAN
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GMDS
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human duodenum and skeletal muscle tissues using Anti-GMDS antibody. Corresponding GMDS RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and GMDS over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419903).
HPA031528
HPA031528
HPA031528