Anti-CAPZB

Catalog Number: ATA-HPA031531
Article Name: Anti-CAPZB
Biozol Catalog Number: ATA-HPA031531
Supplier Catalog Number: HPA031531
Alternative Catalog Number: ATA-HPA031531-100,ATA-HPA031531-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAPZB
capping protein (actin filament) muscle Z-line, beta
Anti-CAPZB
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 832
UniProt: P47756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: CAPZB
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Western blot analysis in human cell line A-431.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA031531-100ul
HPA031531-100ul
HPA031531-100ul