Anti-HAS3
Catalog Number:
ATA-HPA031554
- Images (7)
| Article Name: | Anti-HAS3 |
| Biozol Catalog Number: | ATA-HPA031554 |
| Supplier Catalog Number: | HPA031554 |
| Alternative Catalog Number: | ATA-HPA031554-100,ATA-HPA031554-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HAS3 |
| hyaluronan synthase 3 |
| Anti-HAS3 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 3038 |
| UniProt: | O00219 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | HAS3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected. |
|
|
Immunohistochemical staining of human lung shows moderate positivity in respiratory epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows moderate to strong positivity in the extracellular matrix. |
|
|
Immunohistochemical staining of human urinary bladder shows moderate to strong positivity in the extracellular matrix. |
|
|
HPA031554-100ul |
|
|
HPA031554-100ul |
|
|
HPA031554-100ul |
Product Guarantee and Expert Support
