Anti-TRIM38

Catalog Number: ATA-HPA031685
Article Name: Anti-TRIM38
Biozol Catalog Number: ATA-HPA031685
Supplier Catalog Number: HPA031685
Alternative Catalog Number: ATA-HPA031685-100,ATA-HPA031685-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RNF15, RORET
tripartite motif containing 38
Anti-TRIM38
Clonality: Polyclonal
Concentration: 0.3 mg/ml
Isotype: IgG
NCBI: 10475
UniProt: O00635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: TRIM38
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, centrosome & cell junctions.
Immunohistochemical staining of human tonsil shows cytoplasmic positivity in germinal center cells.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA031685-100ul
HPA031685-100ul
HPA031685-100ul