Anti-CGAS

Catalog Number: ATA-HPA031701
Article Name: Anti-CGAS
Biozol Catalog Number: ATA-HPA031701
Supplier Catalog Number: HPA031701
Alternative Catalog Number: ATA-HPA031701-100,ATA-HPA031701-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C6orf150, h-cGAS, MB21D1
Clonality: Polyclonal
Concentration: 0,05
NCBI: 115004
UniProt: Q8N884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SNTRAYYFVKFKRNPKENHLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALE
Target: CGAS
HPA031701-100ul