Anti-ZZEF1
Catalog Number:
ATA-HPA031790
- Images (7)
| Article Name: | Anti-ZZEF1 |
| Biozol Catalog Number: | ATA-HPA031790 |
| Supplier Catalog Number: | HPA031790 |
| Alternative Catalog Number: | ATA-HPA031790-100,ATA-HPA031790-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ10821, KIAA0399, ZZZ4 |
| zinc finger, ZZ-type with EF-hand domain 1 |
| Anti-ZZEF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 23140 |
| UniProt: | O43149 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LNDRSLLPALSCVQTALLHLLDMGWEPNDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWMDECQDGMF |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ZZEF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules. |
|
|
HPA031790-100ul |
|
|
HPA031790-100ul |
|
|
HPA031790-100ul |
Product Guarantee and Expert Support
